https://pornmeka.com/tags/butt-crack/ Tue 14 Apr 2026 23:30:19 +0200 https://pornmeka.com/videos/1623530/window-cleaner-s-buttcrack/
I've come to clean your windows and glass wear. i get busy cleaning not noticing that my jeans keep slipping further and further down until my butt is fully exposed. ]]> Wed 11 Mar 2026 19:58:11 +0200 https://pornmeka.com/videos/1623530/window-cleaner-s-buttcrack/ https://pornmeka.com/videos/1620788/girl-girl-cleaners-buttcrack/
Clarissa and hotprincessanna cime to clean your house and their buttcracks keep falling out ]]> Mon 09 Mar 2026 20:54:45 +0200 https://pornmeka.com/videos/1620788/girl-girl-cleaners-buttcrack/ https://pornmeka.com/videos/1620761/sagged-jeans-buttcrack/
Custom - i have come back from a night out and im all over the place and i keep falling over. my jeans sag down so much under my ass and when i bend over you can see my tampon hanging out. i end up falling and having a seizure in the kitchen and pissing myself ]]> Mon 09 Mar 2026 20:44:47 +0200 https://pornmeka.com/videos/1620761/sagged-jeans-buttcrack/ https://pornmeka.com/videos/1611051/sweaty-milf-makes-you-sniff-and-lick-her-armpits-stinky-ass-and-feet-like-a-good-boy/
Sweaty milf makes you sniff and lick her armpits, stinky ass and feet like a good boy vivian dash is back from the gym sweaty and smelly. she sniffs her feet, then shows her armpits close, smells and licks them telling you to be a good boy and do the same.then she slowly pulls her leggings down, teasing you with her butt crack, and finally spreads her smelly ass wide open, telling you to sniff her stinky ass and lick it clean like a good boy. by the end, she fingers her ass and sniffs the finger. vivian is wearing a black tank top and red leggings, no panties or bra, barefoot. 4m28s in full hd 1080p subtitled tags:sniffarmpitspread assleggingsbarefootfeetbig buttanal fingeringsmellysmellsweatylickbig butt teasebuttcrack ]]> Wed 04 Mar 2026 14:51:21 +0200 https://pornmeka.com/videos/1611051/sweaty-milf-makes-you-sniff-and-lick-her-armpits-stinky-ass-and-feet-like-a-good-boy/ https://pornmeka.com/videos/1607574/trapped-in-her-panties-tiny-boyfriend-sneaky-pet-hiding-in-between-ass-cheeks-gets-smother-ass-smothering-no-sound/
This video contains only a heavy rainstorm sound!!! i was recording during an heavy rainstorm..hahaha.. i never thought or knew it would affect the clip, unfortunately it did. my voice could not be heard in the video at all. so, if you like white noise, then enjoy the video or if you don't mind, you can turn down the volume.  description:  getting ready for a day at the mall, i was slipping into my favorite lace panties when i felt a tiny, wriggling surprise fall out from between my ass cheeks. my sneaky little pet, with his filthy obsession for my scent, thought he could hide there without my permission. his disobedience needed immediate correction. i didn't just put him back; i stuffed him deep into the warm, dark crevice of my ass, where my skin was still damp from my shower. i clenched my cheeks tightly, smothering him in my powerful, musky aroma. i could feel his tiny struggles against my flesh as he was engulfed by my overwhelming scent and heat. he wanted to smell my ass so badly? well, now you are going to live in it. i finished dressing, pulling my tight jeans up over my panties, sealing him in his perfect, fragrant prison. now you are coming to the mall with me, trapped against my skin, breathing nothing but my essence with every step i take. let's see if he learns his lesson. ]]> Mon 02 Mar 2026 12:24:21 +0200 https://pornmeka.com/videos/1607574/trapped-in-her-panties-tiny-boyfriend-sneaky-pet-hiding-in-between-ass-cheeks-gets-smother-ass-smothering-no-sound/ https://pornmeka.com/videos/1606779/anal-assfyxiation-tiny-stuffed-between-ass-cheeks-anal-vore-ass-smothering-ebony-ass-fetish/
You pathetic, microscopic worm. did you honestly believe you could conceal your worthless little body between my massive, supreme goddess ass cheeks without me noticing? while i'm strutting through my domain, completely unaware of your insignificant existence, you've been squirming in my crack like the desperate insect you are. oh, but goddess bey sees everything. the second my divine milf senses detected your tiny form messing up my sacred space, your brutal punishment became inevitable. this isn't just a lesson – this is your complete annihilation. watch me seize your trembling, insect-sized body and violently shove your entire head deep into my tight, puckered asshole. feel my powerful sphincter muscles wrap around your scrawny little neck like a crushing vice, squeezing and constricting with every pulse of my dominant anal walls. your pathetic whimpers and gasps for air mean absolutely nothing as my hot asshole grips your throat, cutting off your oxygen while your face is buried in my forbidden tunnel. my massive, perfect ass cheeks clench around your struggling form as your head disappears completely inside my anal cavity, your neck caught in the tightest, most degrading chokehold imaginable. you wanted to worship this ass? now you're breathless inside it. every flex of my cruel sphincter crushes your windpipe, reminding you that your only purpose is to serve as my human anal plug – a living, suffering toy for my amusement. your tiny cock probably throbs as you struggle, doesn't it? disgusting. this is what happens when you disrespect your giantess owner. your lesson doesn't end until * decide you've suffered enough... and i'm nowhere near finished squeezing your life away with my giantess asshole. ]]> Sun 01 Mar 2026 19:47:05 +0200 https://pornmeka.com/videos/1606779/anal-assfyxiation-tiny-stuffed-between-ass-cheeks-anal-vore-ass-smothering-ebony-ass-fetish/ https://pornmeka.com/videos/1600904/sagging-pants-buttcrack-ass-fetish/
My pants are sagging , exposing my big ass while i look for balloons and decoration ]]> Fri 27 Feb 2026 16:30:05 +0200 https://pornmeka.com/videos/1600904/sagging-pants-buttcrack-ass-fetish/ https://pornmeka.com/videos/1586115/loose-bra-low-and-waist-leggings-match/
These girls are wrestling with low waist loose bras in this tough submission match showing their butt crack and boobs popping out ]]> Wed 18 Feb 2026 12:34:17 +0200 https://pornmeka.com/videos/1586115/loose-bra-low-and-waist-leggings-match/ https://pornmeka.com/videos/1568000/farting-in-the-kitchen-ass-worship/
Farting in the kitchen ]]> Sat 07 Feb 2026 22:26:04 +0200 https://pornmeka.com/videos/1568000/farting-in-the-kitchen-ass-worship/ https://pornmeka.com/videos/1545351/the-plumbers-buttcrack/
I've come to fix your sink. not knowing my ass is hanging out the whole time ]]> Sun 25 Jan 2026 20:34:25 +0200 https://pornmeka.com/videos/1545351/the-plumbers-buttcrack/ https://pornmeka.com/videos/1539053/buttcrack-big-ass-worship-cleaning-the-kitchen/
Buttcrack big ass worship cleaning the kitchen ]]> Thu 22 Jan 2026 14:26:10 +0200 https://pornmeka.com/videos/1539053/buttcrack-big-ass-worship-cleaning-the-kitchen/ https://pornmeka.com/videos/1534236/buttcrack-joi/
In giving you jerk off instructions with my huge buttcrack and beautiful peachy ass. teasing you and making you nuts and full of desire. you wish to goon and grab my butt right? it's yours  ]]> Mon 19 Jan 2026 18:19:14 +0200 https://pornmeka.com/videos/1534236/buttcrack-joi/